PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00006068-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 73aa    MW: 8462.83 Da    PI: 9.2233
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00006068-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.35.7e-301363151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien + rqvtfskRrng+lKKA+ELSvLC+aeva i+fs++g+lye+ss
  WALNUT_00006068-RA 13 KRIENATSRQVTFSKRRNGLLKKAYELSVLCEAEVAAIVFSQKGRLYEFSS 63
                        79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-40564IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.637565IPR002100Transcription factor, MADS-box
CDDcd002657.42E-37764No hitNo description
SuperFamilySSF554554.19E-29768IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-31727IPR002100Transcription factor, MADS-box
PfamPF003198.8E-271461IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-312742IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-314263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MCEEMVRGKI QLKRIENATS RQVTFSKRRN GLLKKAYELS VLCEAEVAAI VFSQKGRLYE  60
FSSSEYVERP DML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-18565161Myocyte-specific enhancer factor 2B
1tqe_R1e-18565161Myocyte-specific enhancer factor 2B
1tqe_Q1e-18565161Myocyte-specific enhancer factor 2B
1tqe_P1e-18565161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779702.16e-34PREDICTED: MADS-box protein SOC1-like, partial
SwissprotQ9FIS13e-32AGL42_ARATH; MADS-box protein AGL42
TrEMBLE9JTV36e-34E9JTV3_COFAR; MADS-box protein TM3 subfamily
TrEMBLF6HAQ13e-34F6HAQ1_VITVI; Putative uncharacterized protein
STRINGVIT_16s0022g02400.t017e-34(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.42e-33AGAMOUS-like 42